Protein Labeling Reagents
Vector Laboratories NEUROBIOTIN Tracer
NEUROBIOTIN Tracer (SP-1120) is an amino derivative of biotin that can be used as an intracellular label for cells, particularly neurons. It is used for visualizing neural architecture and for the identification of gap junction coupling. Can be used in many types of preparations including in vivo, whole mounts, slice preparations, or cultured cells - Can be delivered by many routes such as intracellular electrodes, microinjection, cut-loading, or scrape-loading - Can be detected using avidin or streptavidin systems with either chromogenic or fluorescence visualization methods
Lumiprobe Cyanine5 NHS ester, 1263093-76-0, 25mg
Molecular formula: C36H42N3BF4O4, Molecular weight: 667.54, Appearance: dark blue solid, Solubility: very poorly soluble in water (0.19 mM = 127 mg/L), good in polar (DMSO, DMF) and chlorinated (DCM, chloroform) organic solvents; Amine-reactive red emitting fluorescent dye for the labeling of proteins/peptides and amino-oligonucleotides. For the labeling of sensitive proteins, use water-soluble sulfo-Cyanine5 NHS ester.
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | MFCD28142475 | 99.5% | 719.36 | C40H55ClN6O4 | 5 MG
Cy5-PEG3-azide is a PEG-based linker dye bearing an azide group for bioorthogonal conjugation. It is designed for use in click chemistry and linker-dependent constructs, enabling efficient attachment to alkyne-bearing partners for bioconjugation and PROTAC synthesis.
- PEG-based linker with azide functionality for click chemistry.
- Compatible with copper-catalyzed and strain-promoted azide-alkyne cycloaddition.
- Suitable for PROTAC synthesis and general bioconjugation workflows.
- High purity for reliable analytical and preparative results.
- Store at -20°C and protect from light; in solution, store at -80°C for long-term.
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Biocare Medical, LLC Reveal Decloaker, 10X - 500 ml
Reveal Decloaker is a heat retrieval solution that is suitable for most antibody-antigen staining and reduces non-specific background staining, blocks endogenous peroxidase and removes mercury crystals. Reveal Decloaker can be used with Biocare's digital electric pressure cooker (Decloaking Chamber), a steamer, a water bath, or a microwave oven. For many antibodies, titers are doubled and background staining is significantly reduced when compared to citrate buffer, pH 6.0. Reveal Decloaker incorporates Assure technology, a color-coded high temperature pH indicator solution. The end-user is assured by visual inspection that the solution is at the correct dilution and pH. This product is specially formulated for superior pH stability at high temperatures and will help prevent the possibility of losing pH sensitive antigens. Reveal Decloaker is non-toxic, non-flammable, odorless and sodium azide and thimerosal free.
Biotium Mix-n-Stain™ CF660C Small Ligand Labeling Kit
Mix-n-Stain™ Small Ligand Labeling Kits are designed for rapid labeling of low molecular weight (MW 150 -5000) ligands without a purification step. Suitable ligands or substrates include SNAP-tag, CLIP-tag™ and HaloTag ligand derivatives that have an aliphatic amine. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF660C dye has excitation/emission at 667/685 nm. It is suitable for labeling ligands for cell surface staining.
Apexbio Technology LLC Cy5 NHS ester(Et),5mg
Other sizes are also available. Please inqury us for quote.
Medchemexpress LLC Sulfo-cyanine5-alkyne | 1345823-20-2 | 95.3% | 693.87 g·mol⁻¹ | C36H43N3O7S2 | 10 MG
CY5-YNE (sulfo-Cyanine5-alkyne) is a clickable fluorescent labeling reagent containing an alkyne for copper-catalyzed azide-alkyne cycloaddition (CuAAC). It is used to covalently label peptides, proteins, and oligonucleotides for fluorescence detection and imaging.
- Alkyne functional group enables click chemistry conjugation.
- Excitation 645 nm, emission 670 nm for Cy5-compatible detection.
- Molecular weight 693.87 g·mol⁻¹ and formula C36H43N3O7S2.
- Provided as solid or 10 mM solution in DMSO for flexible use.
- Reported purity ≈95.3%; store protected from light.
Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*
The single TAMRA isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes.
Medchemexpress LLC HY-D0893 5mg Medchemexpress, NSP-SA-NHS CAS:199293-83-9 Purity:>98%
Medchemexpress, HY-D0893 5mg NSP-SA-NHS CAS:199293-83-9 NSP-SA-NHS is a chemiluminescent acridinium ester. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific FAM-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt) 0.5MG
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYPMOLECULAR FORMULA: C157H220N40O37S1MOLECULAR WEIGHT:3291.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [16960-16-0], RESEARCH AREA: HormonalREFERENCES: Y.F.Jacquet, Science, 201, 1032 (1978)
Medchemexpress LLC HY-50938 50mg Medchemexpress, D149 Dye CAS:786643-20-7 Purity:>98%
Medchemexpress, HY-50938 50mg D149 Dye CAS:786643-20-7 D149 Dye is an indoline-based dye, which is a high-extinction-coefficient metal-free organic sensitizer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC HY-111377 5mg Medchemexpress, Amine-PEG3-Biotin CAS:359860-27-8 Purity:>98%
Medchemexpress, HY-111377 5mg Amine-PEG3-Biotin CAS:359860-27-8 Amine-PEG3-Biotin is used as a signal amplification label. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
![eMolecules sulfo-Cy7.5 maleimide | Broadpharm |1205.520 | C51H51K3N4O15S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCCN4C(=O)C=CC4=O)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705736](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502461280.JPG-250.jpg)
eMolecules sulfo-Cy7.5 maleimide | Broadpharm |1205.520 | C51H51K3N4O15S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCCN4C(=O)C=CC4=O)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705736
sulfo-Cy7.5 maleimide | Broadpharm |1205.520 | C51H51K3N4O15S4 | 0.000 | [K+].[K+].[K+].CN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCCN4C(=O)C=CC4=O)c4ccc5c(cc(cc5c4C3(C)C)S([O-])(=O)=O)S([O-])(=O)=O)=C2)C(C)(C)c2c1ccc1c(cc(cc21)S([O-])(=O)=O)S([O-])(=O)=O | 1mg | 761705736
Biocare Medical, LLC Background Sniper - 100 ml
Background Sniper is specifically formulated for superior pH stability and is sodium azide and thimerosal free. It is a universal blocking reagent used for reducing nonspecific background staining often found with immunohistochemistry, ELISA, immunoelectron microscopy and immunogold techniques. Casein has proven to be a superior blocking reagent as compared to serum proteins. It can also be used on an automated staining system.